Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated

This Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Keratin-associated protein 4-16 KRTAP4-16 KRTAP4-16P KRTAP4P1

UniProt

G5E9R7

Expression Region

1-235

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCSSKMPCSPSASSLCAASPPNCCHPSCCQTTCCRTTSCSHSCSVSSCCRPQCCHSVCCQPTCCRPSCCQTTCCRTTCCHPSCCVSSCCRPQCCHSVCFQPTCCHPSCCISSSCCPSCCESSCCCPCCCLRPVCGRVSCHVTCYHPTCVISTCPHPLCCASPPLPLPFPSPPVPLPFFLSLALPSPPRPSPPLLSPVLIPSPSPSPSLPSLSPPLPSPPLPSPHFPSVNPKSMLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Synaptotagmin-5 (Syt5)
MBS951245 Inquire

Recombinant Rat Synaptotagmin-5 (Syt5)

Sign In for Pricing
View Details
C14orf60 sgRNA CRISPR Lentivector (Human) (Target 3)
K0299004 1.0 µg DNA

C14orf60 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
p53 antibody (FITC)
MBS5310624-01 0.1 mg

p53 antibody (FITC)

Sign In for Pricing
View Details
p53 antibody (FITC)
MBS5310624-02 5x 0.1 mg

p53 antibody (FITC)

Sign In for Pricing
View Details
CALML4 Protein Vector (Mouse) (pPB-N-His)
PV161139 500 ng

CALML4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ML1055 Protein (aa 1-100)
VAng-Yyj2117-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae ML1055 Protein (aa 1-100)

Sign In for Pricing
View Details