Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated

This Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated spans the amino acid sequence from region 2-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stathmin domain-containing protein 1 STMND1

UniProt

H3BQB6

Expression Region

2-276

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GCGPSQPAEDRRRVRAPKKGWKEEFKADVSVPHTGENCSPRMEAALTKNTVDIAEGLEQVQMGSLPGTISENSPSPSERNRRVNSDLVTNGLINKPQSLESRERQKSSDILEELIVQGIIQSHSKVFRNGESYDVTLTTTEKPLRKPPSRLKKLKIKKQVKDFTMKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX3L (NM_138287) Human Recombinant Protein
TP307944M 100 µg

DTX3L (NM_138287) Human Recombinant Protein

Sign In for Pricing
View Details
AJUBA (NM_032876) Human Recombinant Protein
TP305482M 100 µg

AJUBA (NM_032876) Human Recombinant Protein

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-11 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
Benzene-d3
TRC-B536543-2.5MG 2.5 mg

Benzene-d3

Sign In for Pricing
View Details
Recombinant Rat IL4RA/CD124 Protein (Fc Tag)
PKSR030323 50 µg

Recombinant Rat IL4RA/CD124 Protein (Fc Tag)

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-39S 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details