Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated

This Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated spans the amino acid sequence from region 2-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stathmin domain-containing protein 1 STMND1

UniProt

H3BQB6

Expression Region

2-276

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GCGPSQPAEDRRRVRAPKKGWKEEFKADVSVPHTGENCSPRMEAALTKNTVDIAEGLEQVQMGSLPGTISENSPSPSERNRRVNSDLVTNGLINKPQSLESRERQKSSDILEELIVQGIIQSHSKVFRNGESYDVTLTTTEKPLRKPPSRLKKLKIKKQVKDFTMKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase N subunit 2 (CPN2) Human Gene Knockout Kit (CRISPR)
KN424427 1 Kit

Carboxypeptidase N subunit 2 (CPN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Candida albicans TaqMan PCR Kit Dx
DxTM34000 24 Reactions

Candida albicans TaqMan PCR Kit Dx

Sign In for Pricing
View Details
Ethyl 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylate
TRC-E792860-25MG 25 mg

Ethyl 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS630578 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
DLL4 Rabbit Polyclonal Antibody
ER1706-29 100 µL

DLL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACVR1B Antibody
F40238-0.08ML 0.08 mL

ACVR1B Antibody

Sign In for Pricing
View Details