Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated

This Recombinant Human Stathmin domain-containing protein 1 (STMD1), Biotinylated spans the amino acid sequence from region 2-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stathmin domain-containing protein 1 STMND1

UniProt

H3BQB6

Expression Region

2-276

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GCGPSQPAEDRRRVRAPKKGWKEEFKADVSVPHTGENCSPRMEAALTKNTVDIAEGLEQVQMGSLPGTISENSPSPSERNRRVNSDLVTNGLINKPQSLESRERQKSSDILEELIVQGIIQSHSKVFRNGESYDVTLTTTEKPLRKPPSRLKKLKIKKQVKDFTMKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pmCherry-N1-Myc-ZBP1 Plasmid
PVT18072 2 µg

pmCherry-N1-Myc-ZBP1 Plasmid

Sign In for Pricing
View Details
PLXNA1 Protein Vector (Human) (pPM-C-His)
PV031832 500 ng

PLXNA1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RBM13 (m) -PR
sc-152727-PR 10 µM - 20 µL

RBM13 (m) -PR

Sign In for Pricing
View Details
FTLP13 ORF Vector (Human) (pORF)
21034011 1.0 µg DNA

FTLP13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DFNB70 Recombinant Protein (Human)
RP054846 100 µg

DFNB70 Recombinant Protein (Human)

Sign In for Pricing
View Details
Reep2 ORF Vector (Mouse) (pORF)
38786014 1.0 µg DNA

Reep2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details