Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP7 Antibody
KC-43999-01 50 μL

AKAP7 Antibody

Sign In for Pricing
View Details
AKAP7 Antibody
KC-43999-02 100 µL

AKAP7 Antibody

Sign In for Pricing
View Details
AKAP7 Antibody
KC-43999-03 1 mL

AKAP7 Antibody

Sign In for Pricing
View Details
HIGD1A (NM_001099669) Human Over-expression Lysate
LY420483 100 µg

HIGD1A (NM_001099669) Human Over-expression Lysate

Sign In for Pricing
View Details
Thyroglobulin (6E1.), CF405S conjugate, 0.1mg/mL
BNC040051-500 1x 500 µL

Thyroglobulin (6E1.), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL
BNC402049-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details