Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4660 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV769732 1.0 µg DNA

MIR4660 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SLC44A2 (NM_020428) Human Tagged ORF Clone
RG207181 10 µg

SLC44A2 (NM_020428) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-LRP5 Antibody Picoband®, APC Conjugate
PA2273-APC 100 µg/Vial

Anti-LRP5 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Defb26 Recombinant Protein (Rat)
RP197795 100 µg

Defb26 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rabbit anti-PVRLl/NECTINl Recombinant Monoclonal Antibody [BLR284L]
A700-284-T 20 µL (2 Blots)

Rabbit anti-PVRLl/NECTINl Recombinant Monoclonal Antibody [BLR284L]

Sign In for Pricing
View Details
TRNAF10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2487207 1.0 µg DNA

TRNAF10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details