Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF), Biotinylated

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF), Biotinylated spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM9SF3 Human Gene Knockout Kit (CRISPR)
KN423270 1 Kit

TM9SF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BID (NM_001196) Human Recombinant Protein
TP720087M 50 µg

BID (NM_001196) Human Recombinant Protein

Sign In for Pricing
View Details
CD41 (CD41 Antigen, CD41b, gp2b, GPalphaIIb, GPIIb, Gta, HPA3, HPA-3, Integrin alpha IIb, Integrin alpha 2b, ITGA2B, ITGAB, Platelet Glycoprotein IIb of IIb/IIIa Complex, Platelet Fibrinogen Receptor alpha, Platelet Membrane Glycoprotein IIb, Platelet specific Antigen Bak) discontinued
C2394-02K 2 mL

CD41 (CD41 Antigen, CD41b, gp2b, GPalphaIIb, GPIIb, Gta, HPA3, HPA-3, Integrin alpha IIb, Integrin alpha 2b, ITGA2B, ITGAB, Platelet Glycoprotein IIb of IIb/IIIa Complex, Platelet Fibrinogen Receptor alpha, Platelet Membrane Glycoprotein IIb, Platelet specific Antigen Bak) discontinued

Sign In for Pricing
View Details
PPA
sc-222185 500 µg

PPA

Sign In for Pricing
View Details
TPA Tissue Plasminogen Activator/PLAT Rabbit Polyclonal Antibody (Fluoro550)
orb3109147 100 µg

TPA Tissue Plasminogen Activator/PLAT Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Protein C (PROC) Rabbit Polyclonal Antibody
TA308939 100 µL

Protein C (PROC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details