Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G3 (OR83P), partial, Biotinylated

This Recombinant Human Olfactory receptor 8G3 (OR83P), partial, Biotinylated spans the amino acid sequence from region 161-197. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G3; Olfactory receptor OR11-297; OR8G3 OR8G3P

UniProt

P0DMU2

Expression Region

161-197

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SFMLRLFLCKTNVINHYFCDLFPLLGLSCSSTYINEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPZ1, NT (COPZ1, COPZ, Coatomer subunit zeta-1, Zeta-1-coat protein) (MaxLight 750) discontinued
034122-ML750 100 µL

COPZ1, NT (COPZ1, COPZ, Coatomer subunit zeta-1, Zeta-1-coat protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human ANKRD34C knockdown cell line
ABC-KD0674 1 Vial

Human ANKRD34C knockdown cell line

Sign In for Pricing
View Details
Rabbit Polyclonal Adenylate Cyclase 5 Antibody
NBP3-06369-100ul 100 µL

Rabbit Polyclonal Adenylate Cyclase 5 Antibody

Sign In for Pricing
View Details
3- (Prop-2-yn-1-yl) morpholine hydrochloride
AVD27380-01 50 mg

3- (Prop-2-yn-1-yl) morpholine hydrochloride

Sign In for Pricing
View Details
3- (Prop-2-yn-1-yl) morpholine hydrochloride
AVD27380-02 0.5 g

3- (Prop-2-yn-1-yl) morpholine hydrochloride

Sign In for Pricing
View Details
GH1 Mouse mAb
63669 100 µL

GH1 Mouse mAb

Sign In for Pricing
View Details