Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated

This Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated spans the amino acid sequence from region 1-216. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda-1 light chain; Immunoglobulin lambda-1 light chain MCG

UniProt

P0DOX8

Expression Region

1-216

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1TD1 Antibody, Biotin conjugated
A57783-50UG 50 µg

L1TD1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CHO-K1/HEK293 Cells Stable expressing GPCR protein S1PR4 (Protein accession # NM_003775)
cAP-1381 1 Frozen Vial

CHO-K1/HEK293 Cells Stable expressing GPCR protein S1PR4 (Protein accession # NM_003775)

Sign In for Pricing
View Details
Mouse Serpine2 / Glia-derived nexin Recombinant Protein
R1912m 1 Each

Mouse Serpine2 / Glia-derived nexin Recombinant Protein

Sign In for Pricing
View Details
HOXA9 protein (His tag)
80R-3800 100 ug

HOXA9 protein (His tag)

Sign In for Pricing
View Details
PE Anti-Human/Mouse IL-5 Antibody
DL22193F-01 25 μg

PE Anti-Human/Mouse IL-5 Antibody

Sign In for Pricing
View Details
PE Anti-Human/Mouse IL-5 Antibody
DL22193F-02 50 μg

PE Anti-Human/Mouse IL-5 Antibody

Sign In for Pricing
View Details