Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated

This Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated spans the amino acid sequence from region 1-216. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda-1 light chain; Immunoglobulin lambda-1 light chain MCG

UniProt

P0DOX8

Expression Region

1-216

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH3 Knockout Cell Lysate
ABC-KC1307 100 µg

NOTCH3 Knockout Cell Lysate

Sign In for Pricing
View Details
Mouse WBSCR16 siRNA
abx939660-01 15 nmol

Mouse WBSCR16 siRNA

Sign In for Pricing
View Details
Mouse WBSCR16 siRNA
abx939660-02 30 nmol

Mouse WBSCR16 siRNA

Sign In for Pricing
View Details
C10orf131 Rabbit Polyclonal Antibody (Biotin)
orb2084623 100 µL

C10orf131 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Morc1 (NM_010816) Mouse Tagged ORF Clone Lentiviral Particle
MR211284L4V 200 µL

Morc1 (NM_010816) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human IL-12/IL-23 p40 ELISA Kit
RK00013 96 Tests

Human IL-12/IL-23 p40 ELISA Kit

Sign In for Pricing
View Details