Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD2A CRISPR Activation Plasmid (m)
sc-432966-ACT 20 µg

JMJD2A CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Egr-2 siRNA (m)
sc-37828 10 µM

Egr-2 siRNA (m)

Sign In for Pricing
View Details
Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]
MBS4382007-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]

Sign In for Pricing
View Details
Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]
MBS4382007-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]

Sign In for Pricing
View Details
Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]
MBS4382007-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]

Sign In for Pricing
View Details
Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]
MBS4382007-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Interleukin-3 (IL-3) Mouse Monoclonal Antibody [Clone IL3/4004]

Sign In for Pricing
View Details