Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-heterochromatin protein 1 (pTyr41) Rabbit Polyclonal Antibody (PerCP)
orb2555647 100 µL

Phospho-heterochromatin protein 1 (pTyr41) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Mouse Monoclonal Caveolin-1 Antibody (7C8) [mFluor Violet 610 SE]
NB100-615MFV610 0.1 mL

Mouse Monoclonal Caveolin-1 Antibody (7C8) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SLC25A16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV715125 1.0 µg DNA

SLC25A16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Slc25a41 Mouse shRNA Plasmid (Locus ID 103775)
TR515460 1 Kit

Slc25a41 Mouse shRNA Plasmid (Locus ID 103775)

Sign In for Pricing
View Details
Rat WS Anterior cerebellum/pons Frozen Coronal Sections, Region 12
RF-201-12-WS 10 Slides

Rat WS Anterior cerebellum/pons Frozen Coronal Sections, Region 12

Sign In for Pricing
View Details
Cyclopropylbenzene
sc-255043 5 g

Cyclopropylbenzene

Sign In for Pricing
View Details