Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E/E061/NL362/ALU-210X297-1 Marine & IMO Signs (No Adhesive)
238301 1 Pack (1 Panel (s) x 1 Pack)

E/E061/NL362/ALU-210X297-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
Muted sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4805806 1.0 µg DNA

Muted sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ER degrader 5
T74857-01 5 mg

ER degrader 5

Sign In for Pricing
View Details
ER degrader 5
T74857-02 50 mg

ER degrader 5

Sign In for Pricing
View Details
ZNF226 antibody - middle region
MBS3209927-01 0.1 mL

ZNF226 antibody - middle region

Sign In for Pricing
View Details
ZNF226 antibody - middle region
MBS3209927-02 5x 0.1 mL

ZNF226 antibody - middle region

Sign In for Pricing
View Details