Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43D IGHV3-43D

UniProt

P0DP04

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-Fluorophenyl) -2- (7-oxo-5H-pyrrolo[3,4-b]pyridin-6 (7h) -yl) acetic acid
PC430553 1 Each

2- (4-Fluorophenyl) -2- (7-oxo-5H-pyrrolo[3,4-b]pyridin-6 (7h) -yl) acetic acid

Sign In for Pricing
View Details
IgG3, Murine Isotype Control (Azide Free)
MBS655554-01 0.5 mg

IgG3, Murine Isotype Control (Azide Free)

Sign In for Pricing
View Details
IgG3, Murine Isotype Control (Azide Free)
MBS655554-02 5x 0.5 mg

IgG3, Murine Isotype Control (Azide Free)

Sign In for Pricing
View Details
Human Separin ELISA Kit
MBS9427545-01 96 Tests

Human Separin ELISA Kit

Sign In for Pricing
View Details
Human Separin ELISA Kit
MBS9427545-02 5x 96 Tests

Human Separin ELISA Kit

Sign In for Pricing
View Details
WASL Antibody
orb1258108 100 µL

WASL Antibody

Sign In for Pricing
View Details