Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB3P 3'UTR GFP Stable Cell Line
TU069040 1.0 mL

PSMB3P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ZNF569 Rabbit pAb, PerCP-Cy7 conjugated
orb2885004 100 µL

ZNF569 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Tagln3 (NM_019754) Mouse Tagged Lenti ORF Clone
MR202013L4 10 µg

Tagln3 (NM_019754) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MAD1 Recombinant Antibody, Cy3 Conjugated
bsm-62140R-Cy3 100 µL

MAD1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
KANK2 Recombinant Protein Antigen
NBP1-89080PEP 0.1 mL

KANK2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Goat β-CG ELISA Kit
EGTBF0015 96 Tests

Goat β-CG ELISA Kit

Sign In for Pricing
View Details