Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat S100A1 Protein, His (Fc)-Avi-tagged
S100A1-4869R 50 µg

Recombinant Rat S100A1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Mouse Receptor-type tyrosine-protein phosphatase F (Ptprf) , partial
MBS1125099 Inquire

Recombinant Mouse Receptor-type tyrosine-protein phosphatase F (Ptprf) , partial

Sign In for Pricing
View Details
SLU7 Rabbit Polyclonal Antibody (Biotin)
orb2594093 100 µg

SLU7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Cyclooxygenase 1 (COX1) Antibody (ALP)
abx446067 100 µg

Cyclooxygenase 1 (COX1) Antibody (ALP)

Sign In for Pricing
View Details
Donkey Keratin 3 (KRT3) ELISA Kit
MBS9395600 Inquire

Donkey Keratin 3 (KRT3) ELISA Kit

Sign In for Pricing
View Details
ADAM Metallopeptidase With Thrombospondin Type 1 Motif 4 (ADAMTS4) Antibody
abx318331-01 20 µg

ADAM Metallopeptidase With Thrombospondin Type 1 Motif 4 (ADAMTS4) Antibody

Sign In for Pricing
View Details