Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S100B Antibody (S1-61) [PE]
NBP2-50282PE 0.1 mL

Mouse Monoclonal S100B Antibody (S1-61) [PE]

Sign In for Pricing
View Details
Rat Eef1a1 Pre-designed siRNA Set B
SI204224B 1 Each

Rat Eef1a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GSTA1 Antibody
K52010C20H09C-01 50 ug

GSTA1 Antibody

Sign In for Pricing
View Details
GSTA1 Antibody
K52010C20H09C-02 100 ug

GSTA1 Antibody

Sign In for Pricing
View Details
GSTA1 Antibody
K52010C20H09C-03 1 mg

GSTA1 Antibody

Sign In for Pricing
View Details
Recombinant Treponema Pallidum troD Protein (aa 1-367)
VAng-Cr1459-1mgEcoli 1 mg (E. coli)

Recombinant Treponema Pallidum troD Protein (aa 1-367)

Sign In for Pricing
View Details