Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF146 (NM_007145) Human Untagged Clone
SC115691 10 µg

ZNF146 (NM_007145) Human Untagged Clone

Sign In for Pricing
View Details
CARHSP1 (NM_001278260) Human Tagged ORF Clone
RG236045 10 µg

CARHSP1 (NM_001278260) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Monoclonal Anti-CD23 Antibody, Rabbit (4C9)
HGS-S244 100 µL

Recombinant Monoclonal Anti-CD23 Antibody, Rabbit (4C9)

Sign In for Pricing
View Details
Htr3b Rat siRNA Oligo Duplex (Locus ID 58963)
SR508917 1 Kit

Htr3b Rat siRNA Oligo Duplex (Locus ID 58963)

Sign In for Pricing
View Details
α-bovine IgM conjugate HRPO
EIAR α-bovine conjugate IgM 1 mL

α-bovine IgM conjugate HRPO

Sign In for Pricing
View Details
CSF1R-IN-2
MBS3613682-01 2 mg

CSF1R-IN-2

Sign In for Pricing
View Details