Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPH3A Antibody
CSB-PA020102GA01HU 100 µL

RPH3A Antibody

Sign In for Pricing
View Details
Histone H2B-K12, acetylated discontinued
530844-01 20 µL

Histone H2B-K12, acetylated discontinued

Sign In for Pricing
View Details
Histone H2B-K12, acetylated discontinued
530844-02 100 µL

Histone H2B-K12, acetylated discontinued

Sign In for Pricing
View Details
CST9 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9217R-PerCP-Cy5.5 100 µL

CST9 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
HAT1 ORF Vector (Human) (pORF)
ORF004801 1.0 µg DNA

HAT1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human FCGR3B Protein, His, Insect-1mg
QP11861-1mg 1mg

Recombinant Human FCGR3B Protein, His, Insect-1mg

Sign In for Pricing
View Details