Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT12 Antibody - N-terminal region
MBS3214363-01 0.1 mL

SYT12 Antibody - N-terminal region

Sign In for Pricing
View Details
SYT12 Antibody - N-terminal region
MBS3214363-02 5x 0.1 mL

SYT12 Antibody - N-terminal region

Sign In for Pricing
View Details
CNDP1 antibody - C-terminal region
MBS3214870-01 0.1 mL

CNDP1 antibody - C-terminal region

Sign In for Pricing
View Details
CNDP1 antibody - C-terminal region
MBS3214870-02 5x 0.1 mL

CNDP1 antibody - C-terminal region

Sign In for Pricing
View Details
TReP132 Polyclonal Antibody, APC Conjugated
bs-7683R-APC 100 µL

TReP132 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal MDM2/HDM2 Antibody (MDM2/7942) [PE]
NBP3-21087PE 0.1 mL

Mouse Monoclonal MDM2/HDM2 Antibody (MDM2/7942) [PE]

Sign In for Pricing
View Details