Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(2-aminoethyl)(nitroso)amine Dihydrochloride
TRC-E741655-10MG 10 mg

Bis(2-aminoethyl)(nitroso)amine Dihydrochloride

Sign In for Pricing
View Details
RTCD1 (RTCA) Human Gene Knockout Kit (CRISPR)
KN414858 1 Kit

RTCD1 (RTCA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTGS1 (NM_000962) Human Recombinant Protein
TP306436 20 µg

PTGS1 (NM_000962) Human Recombinant Protein

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (V9), Biotin conjugate, 0.1mg/mL
BNCB2775-500 1x 500 µL

Vimentin (Mesenchymal Cell Marker) (V9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GC 1
TRC-G932045-2.5MG 2.5 mg

GC 1

Sign In for Pricing
View Details
GATA3 Human Gene Knockout Kit (CRISPR)
KN201618BN 1 Kit

GATA3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details