Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (34BE12), CF640R conjugate, 0.1mg/mL
BNC400446-100 1x 100 µL

Cytokeratin, HMW (34BE12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ypel3 Mouse Gene Knockout Kit (CRISPR)
KN519562 1 Kit

Ypel3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE6 alpha Rabbit Polyclonal Antibody
HA500264 100 µL

PDE6 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU pSer214 Rabbit Polyclonal Antibody
AP01703PU-N 100 µg

MAPT / TAU pSer214 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL
BNC940675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta actin Polyclonal Antibody
E-AB-40517-01 25 µL

Beta actin Polyclonal Antibody

Sign In for Pricing
View Details