Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10J5 HDR Plasmid (h)
sc-418455-HDR 20 µg

OR10J5 HDR Plasmid (h)

Sign In for Pricing
View Details
IL-1 Alpha Propeptide Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-10540R-PE-Cy5.5 100 µL

IL-1 Alpha Propeptide Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-DNMBP Polyclonal Antibody
PAV1208 100 μL

Rabbit Anti-DNMBP Polyclonal Antibody

Sign In for Pricing
View Details
Skiv2l-set siRNA/shRNA/RNAi Lentivector (Mouse)
43841094 4x 500 ng

Skiv2l-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Sheep Mouse IgG Heavy and Light Chain Antibody
orb1518990 1 mg

Sheep Mouse IgG Heavy and Light Chain Antibody

Sign In for Pricing
View Details
2-C- (2,3,4,6-Tetra-O-benzyl-a-D-glucopyranosyl) ethyne
294988-01 1 g

2-C- (2,3,4,6-Tetra-O-benzyl-a-D-glucopyranosyl) ethyne

Sign In for Pricing
View Details