Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130A (D130A), Biotinylated

This Recombinant Human Beta-defensin 130A (D130A), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130A; Beta-defensin 130; Beta-defensin 30; DEFB-30; Defensin, beta 130; DEFB130A DEFB130 DEFB30

UniProt

P0DP74

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAS21 3'UTR Luciferase Stable Cell Line
TU027137 1.0 mL

TRNAS21 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rftn2 Mouse siRNA Oligo Duplex (Locus ID 74013)
SR411592 1 Kit

Rftn2 Mouse siRNA Oligo Duplex (Locus ID 74013)

Sign In for Pricing
View Details
Mouse Creatine kinase B-type,CKB ELISA KIT
JOT-EK1978Mo-01 96 Well

Mouse Creatine kinase B-type,CKB ELISA KIT

Sign In for Pricing
View Details
Mouse Creatine kinase B-type,CKB ELISA KIT
JOT-EK1978Mo-02 48 Well

Mouse Creatine kinase B-type,CKB ELISA KIT

Sign In for Pricing
View Details
H BSG (CD147) Expression Lentivirus
LVP542 1x 10^7 IFU/mL - 200 μL

H BSG (CD147) Expression Lentivirus

Sign In for Pricing
View Details
2-Amino-3-methylbenzoic acid
FA54893-01 1 Kg

2-Amino-3-methylbenzoic acid

Sign In for Pricing
View Details