Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial, Biotinylated

This Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial, Biotinylated spans the amino acid sequence from region 22-263. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 8 VSIG8 C1orf204

UniProt

P0DPA2

Expression Region

22-263

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin K2 (5) -D7
HY-W769519 1 Each

Vitamin K2 (5) -D7

Sign In for Pricing
View Details
Ephrin B2 (EFNB2), Recombinant, Human, His-Tag
050434-01 10 µg

Ephrin B2 (EFNB2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Ephrin B2 (EFNB2), Recombinant, Human, His-Tag
050434-02 50 µg

Ephrin B2 (EFNB2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Ephrin B2 (EFNB2), Recombinant, Human, His-Tag
050434-03 100 µg

Ephrin B2 (EFNB2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Ephrin B2 (EFNB2), Recombinant, Human, His-Tag
050434-04 200 µg

Ephrin B2 (EFNB2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Ethoxymethylene malononitrile
275104-01 100 g

Ethoxymethylene malononitrile

Sign In for Pricing
View Details