Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Condurango glycoside A0
HY-N12237-01 1 mg

Condurango glycoside A0

Sign In for Pricing
View Details
Condurango glycoside A0
HY-N12237-02 5 mg

Condurango glycoside A0

Sign In for Pricing
View Details
Condurango glycoside A0
HY-N12237-03 10 mg

Condurango glycoside A0

Sign In for Pricing
View Details
FASTKD1 Antibody
OAAN02251-200UL 200 µL

FASTKD1 Antibody

Sign In for Pricing
View Details
Anti-TRFP/MED20 Antibody Picoband® Fluoro647 Conjugated
A09407-1-Fluoro647 100 µg/Vial

Anti-TRFP/MED20 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
APC Anti-Mouse TER-119 Antibody
JOT21586F 25μg

APC Anti-Mouse TER-119 Antibody

Sign In for Pricing
View Details