Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3,4-Dichlorophenoxy) benzaldehyde
OR5239 1 Each

3- (3,4-Dichlorophenoxy) benzaldehyde

Sign In for Pricing
View Details
FABP12 CRISPR All-in-one AAV vector set (with saCas9)(Human)
19635151 3x 1.0 µg DNA

FABP12 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
SPG7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2271906 1.0 µg DNA

SPG7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human CCDC54 shRNA (UAS) - Lentiviral human CCDC54 shRNA (UAS) (25)
GTR15325544 1 Vial

Lentiviral human CCDC54 shRNA (UAS) - Lentiviral human CCDC54 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit gamma glutamyl transpeptidase 1, GGT1 GENLISA ELISA
KLX0168 96 Well

Rabbit gamma glutamyl transpeptidase 1, GGT1 GENLISA ELISA

Sign In for Pricing
View Details
CTTNBP2NL, NT (CTTNBP2NL, KIAA1433, CTTNBP2 N-terminal-like protein) (MaxLight 490)
MBS6289985-01 0.1 mL

CTTNBP2NL, NT (CTTNBP2NL, KIAA1433, CTTNBP2 N-terminal-like protein) (MaxLight 490)

Sign In for Pricing
View Details