Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pUSF1-Luc-HYG-GFP
LR-2074G 2 µg

pUSF1-Luc-HYG-GFP

Sign In for Pricing
View Details
Mouse CD5 Antigen Like Protein (CD5L) ELISA Kit
JL41930-01 48 Tests

Mouse CD5 Antigen Like Protein (CD5L) ELISA Kit

Sign In for Pricing
View Details
Mouse CD5 Antigen Like Protein (CD5L) ELISA Kit
JL41930-02 96 Tests

Mouse CD5 Antigen Like Protein (CD5L) ELISA Kit

Sign In for Pricing
View Details
Human KDM4E activation kit by CRISPRa
GA118140 1 Kit

Human KDM4E activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Coagulation Factor VII (F7)
MBS2012039-01 0.01 mg

Recombinant Coagulation Factor VII (F7)

Sign In for Pricing
View Details
Recombinant Coagulation Factor VII (F7)
MBS2012039-02 0.05 mg

Recombinant Coagulation Factor VII (F7)

Sign In for Pricing
View Details