Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated

This Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transfer Pipettes
P4115-11 500 Units/Case

Transfer Pipettes

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody
TA377901 100 µL

Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fos B (FOSB) Mouse Monoclonal Antibody [Clone ID: OTI6H6]
CF804226 100 µg

Fos B (FOSB) Mouse Monoclonal Antibody [Clone ID: OTI6H6]

Sign In for Pricing
View Details
4-Chlorobenzal Chloride
TRC-C364155-5G 5 g

4-Chlorobenzal Chloride

Sign In for Pricing
View Details
3-(2-Bromoethoxy)prop-1-ene
TRC-B870025-50MG 50 mg

3-(2-Bromoethoxy)prop-1-ene

Sign In for Pricing
View Details
Human Centrin 3 (CETN3) activation kit by CRISPRa
GA100771 1 Kit

Human Centrin 3 (CETN3) activation kit by CRISPRa

Sign In for Pricing
View Details