Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated

This Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF740 conjugate, 0.1mg/mL
BNC742206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRPS1 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50064PU-N 100 µL

PRPS1 Mouse Monoclonal Antibody [Clone ID: AT1E11]

Sign In for Pricing
View Details
Bcl-2 (124), CF568 conjugate, 0.1mg/mL
BNC680530-500 1x 500 µL

Bcl-2 (124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
M Cadherin (CDH15) Human Gene Knockout Kit (CRISPR)
KN401114 1 Kit

M Cadherin (CDH15) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine-d7 (Mixture of Diastereomers)
TRC-A173712-5MG 5 mg

N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine-d7 (Mixture of Diastereomers)

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL
BNC943168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details