Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated

This Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 Antibody (phospho-S315)
F48432-0.08ML 0.08 mL

p53 Antibody (phospho-S315)

Sign In for Pricing
View Details
Human ACKR3 activation kit by CRISPRa
GA111334 1 Kit

Human ACKR3 activation kit by CRISPRa

Sign In for Pricing
View Details
2'-Hydroxy 5'-O-DMT 3'-O-Succinate N-(2-phenoxyacetyl)-Adenosine Potassium
TRC-H253640-50MG 50 mg

2'-Hydroxy 5'-O-DMT 3'-O-Succinate N-(2-phenoxyacetyl)-Adenosine Potassium

Sign In for Pricing
View Details
Tissue Total RNA, Synovium
CR562303 5 µg

Tissue Total RNA, Synovium

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF568 conjugate, 0.1mg/mL
BNC681739-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1739), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Medium Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB0F2-MB 50x 96 Well Plates

Medium Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details