Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated

This Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC10A2 shRNA Plasmid
abx954445-01 150 µg

Human SLC10A2 shRNA Plasmid

Sign In for Pricing
View Details
Human SLC10A2 shRNA Plasmid
abx954445-02 300 µg

Human SLC10A2 shRNA Plasmid

Sign In for Pricing
View Details
ADAMTS12 Antibody, HRP conjugated
A11919-100UG 100 µg

ADAMTS12 Antibody, HRP conjugated

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS509863 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
Uchl4 ORF Vector (Mouse) (pORF)
49074014 1.0 µg DNA

Uchl4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Porcine PDGF B ELISA Kit (Ready to Use)
orb554428-01 48 Tests

Porcine PDGF B ELISA Kit (Ready to Use)

Sign In for Pricing
View Details