Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial, Biotinylated

This Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial, Biotinylated spans the amino acid sequence from region 1-39. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4-2 NPY4R2

UniProt

P0DQD5

Expression Region

1-39

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2-Dimethyl-1- (4-methylphenyl) propan-1-ol
GAA01394-01 50 mg

2,2-Dimethyl-1- (4-methylphenyl) propan-1-ol

Sign In for Pricing
View Details
2,2-Dimethyl-1- (4-methylphenyl) propan-1-ol
GAA01394-02 0.5 g

2,2-Dimethyl-1- (4-methylphenyl) propan-1-ol

Sign In for Pricing
View Details
Rabbit Prostaglandin E3 (PGE3) ELISA Kit
EIA07296Rb 1 Kit

Rabbit Prostaglandin E3 (PGE3) ELISA Kit

Sign In for Pricing
View Details
VAPA
CSB-CL878947HU 10 μg Plasmid + 200 μL Glycerol

VAPA

Sign In for Pricing
View Details
PION, CT (PION, GSAP, Gamma-secretase-activating protein, Protein pigeon homolog, Gamma-secretase-activating protein 16kD C-terminal form) (APC)
MBS6334191-01 0.2 mL

PION, CT (PION, GSAP, Gamma-secretase-activating protein, Protein pigeon homolog, Gamma-secretase-activating protein 16kD C-terminal form) (APC)

Sign In for Pricing
View Details
PION, CT (PION, GSAP, Gamma-secretase-activating protein, Protein pigeon homolog, Gamma-secretase-activating protein 16kD C-terminal form) (APC)
MBS6334191-02 5x 0.2 mL

PION, CT (PION, GSAP, Gamma-secretase-activating protein, Protein pigeon homolog, Gamma-secretase-activating protein 16kD C-terminal form) (APC)

Sign In for Pricing
View Details