Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E11 (SPD11), Biotinylated

This Recombinant Human Speedy protein E11 (SPD11), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E11 SPDYE11

UniProt

P0DTA3

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEKK1/MAP3K1 Rabbit Polyclonal Antibody (Fluoro647)
orb3081256 100 µg

MEKK1/MAP3K1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Gm7020 3'UTR GFP Stable Cell Line
TU158518 1.0 mL

Gm7020 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat anti Apolipoprotein E
MBS316579 Inquire

Goat anti Apolipoprotein E

Sign In for Pricing
View Details
ELISA Flex: Mouse IL-6 (HRP)
3361-1H-20 For 20 Plates

ELISA Flex: Mouse IL-6 (HRP)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Protein yellow (y), partial
MBS1147084 Inquire

Recombinant Drosophila melanogaster Protein yellow (y), partial

Sign In for Pricing
View Details
N-Methylpiperidine
22821532 100 g

N-Methylpiperidine

Sign In for Pricing
View Details