Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXB1 (NM_002144) Human Over-expression Lysate
LY419506 100 µg

HOXB1 (NM_002144) Human Over-expression Lysate

Sign In for Pricing
View Details
BOB1 Rabbit Polyclonal Antibody
ER1803-97 100 µL

BOB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
trans-Campestanyl Ferulate
TRC-C155308-1MG 1 mg

trans-Campestanyl Ferulate

Sign In for Pricing
View Details
Pigment Yellow 180
TRC-P437800-1G 1 g

Pigment Yellow 180

Sign In for Pricing
View Details
Ddr1 Mouse Gene Knockout Kit (CRISPR)
KN304371LP 1 Kit

Ddr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Olfr508 Rabbit Polyclonal Antibody
TA363553 100 µL

Olfr508 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details