Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Swine Mouse IgG (heavy and light chains), conjugated with FITC Antibody
orb21590 2 mL

Swine Mouse IgG (heavy and light chains), conjugated with FITC Antibody

Sign In for Pricing
View Details
B Raf (BRAF) Mouse Monoclonal Antibody [Clone ID: 1H12F1]
AM06152SU-N 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody [Clone ID: 1H12F1]

Sign In for Pricing
View Details
4- (Pentafluorothio) benzeneboronic acid, pinacol ester
PC501675 1 Each

4- (Pentafluorothio) benzeneboronic acid, pinacol ester

Sign In for Pricing
View Details
Cholic Acid-24-13C
TRC-C432601-1MG 1 mg

Cholic Acid-24-13C

Sign In for Pricing
View Details
Chicken T1 Antibody
GWB-Q00906 0.25 mg

Chicken T1 Antibody

Sign In for Pricing
View Details
Human MYF6 Knockout HEK293T cell line
GTR15411031 1 Vial

Human MYF6 Knockout HEK293T cell line

Sign In for Pricing
View Details