Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial, Biotinylated

This Recombinant Human Transmembrane protein 276 (TM276), partial, Biotinylated spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethion Monooxon
TRC-E284670-250MG 250 mg

Ethion Monooxon

Sign In for Pricing
View Details
Tsg101 Mouse Gene Knockout Kit (CRISPR)
KN518331 1 Kit

Tsg101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Claudin 5 Antibody
8C0145-AAT 50 µg

Claudin 5 Antibody

Sign In for Pricing
View Details
Mouse Atp5k activation kit by CRISPRa
GA200331 1 Kit

Mouse Atp5k activation kit by CRISPRa

Sign In for Pricing
View Details
Caldesmon (CALD1) Rabbit Polyclonal Antibody
AP17164PU-N 400 µL

Caldesmon (CALD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PYCR1 Mouse Monoclonal Antibody [Clone ID: OTI4F2]
CF811756 100 µg

PYCR1 Mouse Monoclonal Antibody [Clone ID: OTI4F2]

Sign In for Pricing
View Details