Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein HRURF (HRURF), Biotinylated

This Recombinant Human Protein HRURF (HRURF), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HRURF; HR upstream open reading frame protein; HRURF U2HR

UniProt

P0DUH7

Expression Region

1-34

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adck4 sgRNA CRISPR Lentivector set (Rat)
K6465501 3x 1.0 µg

Adck4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
pExpress-1-Tent2 Plasmid
PVT55639 2 µg

pExpress-1-Tent2 Plasmid

Sign In for Pricing
View Details
2-Bromomethylphenylboronic acid
416357-01 100 mg

2-Bromomethylphenylboronic acid

Sign In for Pricing
View Details
2-Bromomethylphenylboronic acid
416357-02 250 mg

2-Bromomethylphenylboronic acid

Sign In for Pricing
View Details
PRDM4 Antibody
orb680482 100 µL

PRDM4 Antibody

Sign In for Pricing
View Details
L-Cystine discontinued. See C9050
268952-01 1 Kg

L-Cystine discontinued. See C9050

Sign In for Pricing
View Details