Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated

This Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP1 (DNA topoisomerase 1) BioAssayTM ELISA Kit (Human) discontinued
359404-01 48 Tests

TOP1 (DNA topoisomerase 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
TOP1 (DNA topoisomerase 1) BioAssayTM ELISA Kit (Human) discontinued
359404-02 96 Tests

TOP1 (DNA topoisomerase 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
TRA16 Recombinant Protein Antigen
NBP2-55864PEP 100 µL

TRA16 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Probable cytosol aminopeptidase (pepA), partial
MBS1354581 Inquire

Recombinant Synechococcus sp. Probable cytosol aminopeptidase (pepA), partial

Sign In for Pricing
View Details
Reagecon Pesticide Internal Standard (4 Compound Mix) in Methanol, acc Water Test HJ827
REPET1262-I 1 mL

Reagecon Pesticide Internal Standard (4 Compound Mix) in Methanol, acc Water Test HJ827

Sign In for Pricing
View Details
WWOX Antibody
E38PA4545 100 µL

WWOX Antibody

Sign In for Pricing
View Details