Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated

This Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PacOrange Anti-non-human primates/ human CD157 Antibody *SY11B5*
115701J0-AAT 100 Tests

PacOrange Anti-non-human primates/ human CD157 Antibody *SY11B5*

Sign In for Pricing
View Details
PAK4 Antibody (Phospho-Ser474)
OASG05661-100UL 100 µL

PAK4 Antibody (Phospho-Ser474)

Sign In for Pricing
View Details
Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7246089-01 48 Well

Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7246089-02 96 Well

Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7246089-03 5x 96 Well

Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit
MBS7246089-04 10x 96 Well

Porcine Cysteine-rich protein 2-binding protein (CSRP2BP) ELISA Kit

Sign In for Pricing
View Details