Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated

This Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC16A Rabbit pAb, BF700 conjugated
orb2827835 100 µL

CLEC16A Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human CHEK2 pAb
PA4412-01 50 μL

Rabbit Anti-Human CHEK2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CHEK2 pAb
PA4412-02 100 μL

Rabbit Anti-Human CHEK2 pAb

Sign In for Pricing
View Details
Mouse Monoclonal CD8 Antibody (OX-8) [mFluor Violet 450 SE]
NBP2-12523MFV450 0.1 mL

Mouse Monoclonal CD8 Antibody (OX-8) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PC6 Recombinant Protein Antigen
NBP1-87326PEP 0.1 mL

PC6 Recombinant Protein Antigen

Sign In for Pricing
View Details
Mouse EIF2aK3 ELISA Kit (Ready to Use)
orb553328-01 48 Tests

Mouse EIF2aK3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details