Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB), Biotinylated

This Recombinant Human Plasminogen-like protein B (PLGB), Biotinylated spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP-1, human Recombinant Protein
BC-032 20 µg

PARP-1, human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Influenza A virus Matrix protein 2 (M), partial
MBS7060881 Inquire

Recombinant Influenza A virus Matrix protein 2 (M), partial

Sign In for Pricing
View Details
C5orf39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
53804111 3x 1.0 µg

C5orf39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human ENPP1 Recombinant Protein
PPT-12516 100 µg

Human ENPP1 Recombinant Protein

Sign In for Pricing
View Details
Triethanolamine-d15
YCA20532 100 mg

Triethanolamine-d15

Sign In for Pricing
View Details
Recombinant Human CD152 Protein
CRP2601-01 10 µg

Recombinant Human CD152 Protein

Sign In for Pricing
View Details