Recombinant Human Putative sodium-coupled neutral amino acid transporter 11 (S38AB), partial, Biotinylated
This Recombinant Human Putative sodium-coupled neutral amino acid transporter 11 (S38AB), partial, Biotinylated spans the amino acid sequence from region 361-406. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative sodium-coupled neutral amino acid transporter 11; Solute carrier family 38 member 11; SLC38A11 AVT2
UniProt
Q08AI6
Expression Region
361-406
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
ITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10329618 96 Well
Bovine F box like/WD repeat containing protein TBL1X (TBL1X) ELISA Kit
Sign In for Pricing
View Details 