Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribulose-phosphate 3-epimerase-like protein 1 (RPEL1), Biotinylated

This Recombinant Human Ribulose-phosphate 3-epimerase-like protein 1 (RPEL1), Biotinylated spans the amino acid sequence from region 1-228. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribulose-phosphate 3-epimerase-like protein 1; EC 5.1.3.1; Ribulose-5-phosphate-3-epimerase-like protein 1; RPEL1

UniProt

Q2QD12

Expression Region

1-228

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASGCKIGPSILNSDLANLGAKCLQMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAEANQYTFHLEATENPGTLIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGEQKFMEDMMPKVHWLRTQFPSLDIEGDGGVGSDTVHKCAEAGANMTVSGSAIMRSEDPRSVINLLRNICSEAAQKRSLDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL
BNC680262-100 1x 100 µL

Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF568 conjugate, 0.1mg/mL
BNC680282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF647 conjugate, 0.1mg/mL
BNC472460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL
BNC471919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL
BNC471227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details