Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial, Biotinylated

This Recombinant Human XK-related protein 6 (XKR6), partial, Biotinylated spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORA Polyclonal Antibody, FITC Conjugated
bs-12878R-FITC 100 µL

BORA Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
L-Aspartic acid Plant Culture Tested
PCT0304-100G 100 g

L-Aspartic acid Plant Culture Tested

Sign In for Pricing
View Details
3-Amino-5-bromobenzoic acid
sc-298904 1 g

3-Amino-5-bromobenzoic acid

Sign In for Pricing
View Details
Mefenpyr-diethyl
MBS5802686 Inquire

Mefenpyr-diethyl

Sign In for Pricing
View Details
Human Brain PrimaCell™9: Normal Nerve Microglia Growth Supplements with Serum (for 500 mL medium)
9-47021 Set

Human Brain PrimaCell™9: Normal Nerve Microglia Growth Supplements with Serum (for 500 mL medium)

Sign In for Pricing
View Details
Phospho-LIMK1-T508/LIMK2-T505 pAb
MBS8574544-01 0.1 mL

Phospho-LIMK1-T508/LIMK2-T505 pAb

Sign In for Pricing
View Details