Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G2 (O8G2P), partial, Biotinylated

This Recombinant Human Olfactory receptor 8G2 (O8G2P), partial, Biotinylated spans the amino acid sequence from region 1-41. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G2; Olfactory receptor 8G4; Olfactory receptor OR11-292; Olfactory receptor TPCR120; OR8G2P OR8G2 OR8G4

UniProt

Q6IF36

Expression Region

1-41

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mea1 shRNA (UAS) - Lentiviral mouse Mea1 shRNA (UAS, RFP) plasmid
GTR15189205 1 Vial

Lentiviral mouse Mea1 shRNA (UAS) - Lentiviral mouse Mea1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ZNF444
CSB-CL026758HU 10 μg Plasmid + 200 μL Glycerol

ZNF444

Sign In for Pricing
View Details
PD-L1 Polyclonal Antibody, Cy5 Conjugated
bs-4941R-Cy5 100 µL

PD-L1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Ets-2 (m) -PR
sc-37856-PR 10 µM - 20 µL

Ets-2 (m) -PR

Sign In for Pricing
View Details
Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) (100)
GTR15190116 1 Vial

Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Protein Kinase C Delta (PKCd) Magnetic Fluorescence Assay Kit
MBS2155480-01 96 Tests

Protein Kinase C Delta (PKCd) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details