Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated

This Recombinant Human T cell receptor gamma variable 9 (TRGV9), Biotinylated spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hgf (NM_001289461) Mouse Untagged Clone
MC228773 10 µg

Hgf (NM_001289461) Mouse Untagged Clone

Sign In for Pricing
View Details
TORC2 (Crtc2, CREB regulated transcription coactivator 2, 4632407F12Rik, Torc2, Transducer of regulated cAMP response element-binding protein (CREB) 2)
208474 100 µg

TORC2 (Crtc2, CREB regulated transcription coactivator 2, 4632407F12Rik, Torc2, Transducer of regulated cAMP response element-binding protein (CREB) 2)

Sign In for Pricing
View Details
NSD2 (G-12) PE
sc-365627 PE 200 µg/mL

NSD2 (G-12) PE

Sign In for Pricing
View Details
SHIP2 (C76A7) Rabbit Monoclonal Antibody
CST 2839T 20 µL

SHIP2 (C76A7) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
hsa-mir-296-5p RT-PCR Primer Set
abx096932 1 nmol

hsa-mir-296-5p RT-PCR Primer Set

Sign In for Pricing
View Details
BDNF Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-2291R-BF350 100 µL

BDNF Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details