Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated
This Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1), Biotinylated spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein KIF25-AS1; KIF25 antisense RNA 1; KIF25 antisense gene protein 1; Protein HGC6.1; KIF25-AS1 C6orf54 NCRNA00300
UniProt
Q9Y6Z4
Expression Region
1-181
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCMAAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMIARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1086-100mg 100 mg
Anti-Mouse PD-L1 (10F.9G2) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details