Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial, Biotinylated

This Recombinant Human Transmembrane protein 265 (TM265), partial, Biotinylated spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC105369261 Mouse Monoclonal Antibody [Clone ID: DF-T1]
AM08160PU-S 100 µg

LOC105369261 Mouse Monoclonal Antibody [Clone ID: DF-T1]

Sign In for Pricing
View Details
VCAM1/CD106 Polyclonal Antibody
AN007260L-01 25 µL

VCAM1/CD106 Polyclonal Antibody

Sign In for Pricing
View Details
VCAM1/CD106 Polyclonal Antibody
AN007260L-02 100 µL

VCAM1/CD106 Polyclonal Antibody

Sign In for Pricing
View Details
2-Propyl-(E)-2-pentenoic Acid
TRC-P839513-50MG 50 mg

2-Propyl-(E)-2-pentenoic Acid

Sign In for Pricing
View Details
Sodium Bitartrate Monohydrate
TRC-S083928-10G 10 g

Sodium Bitartrate Monohydrate

Sign In for Pricing
View Details
6-Hydroxy Bentazon
TRC-H806500-5MG 5 mg

6-Hydroxy Bentazon

Sign In for Pricing
View Details