Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B), Biotinylated

This Recombinant Human Beta-defensin 131B (D131B), Biotinylated spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin Converting Enzyme 2 (ACE2) (N-term) Rabbit Polyclonal Antibody
AP22858PU-N 50 µg

Angiotensin Converting Enzyme 2 (ACE2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF647 conjugate, 0.1mg/mL
BNC471857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IKK beta Recombinant Rabbit Monoclonal Antibody [JE32-81]
HA721715 100 µL

IKK beta Recombinant Rabbit Monoclonal Antibody [JE32-81]

Sign In for Pricing
View Details
Mix-n-StainTM CF®680 Nanobody Thiol Labeling Kit, 1x (20-50ug) labeling
#92596 1 Kit

Mix-n-StainTM CF®680 Nanobody Thiol Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Placental Alkaline Phosphatase Polyclonal Antibody
E-AB-14764-01 20 µL

Placental Alkaline Phosphatase Polyclonal Antibody

Sign In for Pricing
View Details
Placental Alkaline Phosphatase Polyclonal Antibody
E-AB-14764-02 60 µL

Placental Alkaline Phosphatase Polyclonal Antibody

Sign In for Pricing
View Details